- GADD153/CHOP Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP2-49550
- 0.1 ml (also 25ul)
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Human
- GADD153/CHOP
- IgG
- Rabbit
- This antibody was developed against a recombinant protein corresponding to amino acids: AESLPFSFGT LSSWELEAWY EDLQEVLSSD ENGGTYVSPP GNEEEESKIF TTLDPASLAW LTEEEPEPAE VTSTSQ
- DNA damage inducible transcript 3
- AltDDIT3, C/EBPzeta, CEBPZ, CHOP, CHOP-10, CHOP10, GADD153
- Polyclonal
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- Apoptosis, Cell Cycle and Replication, DNA Repair, Hypoxia, Lipid and Metabolism, Neuroscience, Unfolded Protein Response
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
AESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQ
Specifications/Features
Available conjugates: Unconjugated